3he4/3/1:D/5:F

Sequences
>3he4-a3-m1-cD (length=44) [Search sequence]
NTVKELKNYIQELEERNAELKNLKEHLKFAKAELEFELAAHKFE
>3he4-a3-m5-cF (length=44) [Search sequence]
NTVKELKNYIQELEERNAELKNLKEHLKFAKAELEFELAAHKFE
Structure information
PDB ID 3he4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Heterospecific coiled-coil pair SYNZIP5:SYNZIP6
Assembly ID 3
Resolution 2.46Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 5
Chain ID D F
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3he4-a3-m1-cD_3he4-a3-m5-cF.pdb.gz
Full biological assembly
Download: 3he4-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3he4/3/1:F/4:D 3he4/3/4:F/5:D

[Back to Home]