3hfk/1/1:D/1:A

Sequences

>3hfk-a1-m1-cD (length=108) [Search sequence]

RMIRILYLLVKPESMSHEQFRKECVVHFQMSAGMPGLHKYEVRLVAGNPTDTAVPYLDVG RIDAIGECWFASEEQYQVYMESDIRKAWFEHGKYFIGQLKPFVTEELV

>3hfk-a1-m1-cA (length=115) [Search sequence]

QFEKIEGRMIRILYLLVKPESMSHEQFRKECVVHFQMSAGMPGLHKYEVRLVAGNPTDTA VPYLDVGRIDAIGECWFASEEQYQVYMESDIRKAWFEHGKYFIGQLKPFVTEELV

Structure information

PDB ID	3hfk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 4-methylmuconolactone methylisomerase (H52A) in complex with 4-methylmuconolactone
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	122
Sequence identity between the two chains	1.0
PubMed citation	19801657

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	C5MR76	C5MR76
Species	395598 (Pseudomonas reinekei)	395598 (Pseudomonas reinekei)
Function annotation	BioLiP:3hfkD	BioLiP:3hfkA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3hfk-a1-m1-cD_3hfk-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3hfk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3hds/1/1:D/1:A 3hds/2/1:C/1:B 3hf5/1/1:D/1:A 3hf5/2/1:C/1:B 3hfk/2/1:C/1:B