3hhg/1/1:C/1:B

Sequences

>3hhg-a1-m1-cC (length=294) [Search sequence]

KTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTE
EGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPH
IRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQS
TEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSD
FLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELGN

>3hhg-a1-m1-cB (length=295) [Search sequence]

Structure information

PDB ID	3hhg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of CrgA, a LysR-type transcriptional regulator from Neisseria meningitidis.
Assembly ID	1
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	80
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q9JXW7	Q9JXW7
Species	491 (Neisseria meningitidis serogroup B)	491 (Neisseria meningitidis serogroup B)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3hhg-a1-m1-cC_3hhg-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3hhg-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3hhg/1/1:A/1:H 3hhg/1/1:D/1:E 3hhg/1/1:F/1:G
Other dimers with similar sequences but different poses	3hhf/1/1:B/1:A 3hhg/1/1:A/1:B 3hhg/1/1:C/1:D 3hhg/1/1:F/1:E 3hhg/1/1:G/1:H