3hhw/1/2:C/2:D

Sequences

>3hhw-a1-m2-cC (length=71) [Search sequence]

AVSDVWSLSKTSTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRSHKEAILLGLRYKK LYNQARVKYSL

>3hhw-a1-m2-cD (length=71) [Search sequence]

AVSDVWSLSKTSTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRSHKEAILLGLRYKK LYNQARVKYSL

Structure information

PDB ID	3hhw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex of a vesicular stomatitis virus empty capsid with the nucleocapsid-binding domain of the phosphoprotein
Assembly ID	1
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	C	D
UniProt accession	P04880	P04880
Species	11277 (Vesicular stomatitis Indiana virus)	11277 (Vesicular stomatitis Indiana virus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3hhw-a1-m2-cC_3hhw-a1-m2-cD.pdb.gz

Full biological assembly Download: 3hhw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3hhw/1/1:A/1:B 3hhw/1/1:A/1:E 3hhw/1/1:B/1:C 3hhw/1/1:C/1:D 3hhw/1/1:D/2:E 3hhw/1/1:E/2:D 3hhw/1/2:A/2:B 3hhw/1/2:A/2:E 3hhw/1/2:B/2:C 3hhz/1/1:A/1:B 3hhz/1/1:A/1:E 3hhz/1/1:C/2:D 3hhz/1/1:D/1:E 3hhz/1/1:D/2:C 3hhz/1/2:A/2:B 3hhz/1/2:A/2:E 3hhz/1/2:D/2:E