3hix/5/1:C/3:C

Sequences
>3hix-a5-m1-cC (length=84) [Search sequence]
AFTILDVRDRSTYNDGHIGAAPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSA
GFEHVSELKGGLAAWKAIGGPTEL
>3hix-a5-m3-cC (length=84) [Search sequence]
AFTILDVRDRSTYNDGHIGAAPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSA
GFEHVSELKGGLAAWKAIGGPTEL
Structure information
PDB ID 3hix (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Rhodanese_3 like domain from Anabaena sp Alr3790 protein. Northeast Structural Genomics Consortium Target NsR437i
Assembly ID 5
Resolution 1.92Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID C C
UniProt accession Q8YQN0 Q8YQN0
Species 103690 (Nostoc sp. PCC 7120 = FACHB-418) 103690 (Nostoc sp. PCC 7120 = FACHB-418)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3hix-a5-m1-cC_3hix-a5-m3-cC.pdb.gz
Full biological assembly
Download: 3hix-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3ilm/2/1:D/1:C 3ilm/1/1:A/1:B
  • 3k9r/5/1:D/1:C 3k9r/1/1:A/1:B 3k9r/1/2:D/2:C 3k9r/2/1:A/1:B
  • 3k9r/4/2:D/1:B 3k9r/1/1:A/2:C 3k9r/1/2:D/1:B 3k9r/3/1:A/2:C
    		•

    [Back to Home]