3hls/5/1:B/1:C

Sequences

>3hls-a5-m1-cB (length=61) [Search sequence]

HATRDLVLLGEQFREEYKLTQELELTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELR H

>3hls-a5-m1-cC (length=61) [Search sequence]

SHATRDLVLLGEQFREEYKLTQELELTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANEL R

Structure information

PDB ID	3hls (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the signaling helix coiled-coil doimain of the BETA-1 subunit of the soluble guanylyl cyclase
Assembly ID	5
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	0.984

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P20595	P20595
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3hls-a5-m1-cB_3hls-a5-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3hls-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3hls/5/1:D/1:A 3hls/6/1:F/1:G 3hls/6/1:H/1:E
Other dimers with similar sequences but different poses	3hls/6/1:F/1:E 3hls/1/1:B/1:A 3hls/2/1:C/1:D 3hls/3/1:F/1:E 3hls/4/1:G/1:H 3hls/5/1:B/1:A 3hls/5/1:C/1:D 3hls/6/1:G/1:H 3hls/6/1:G/1:E 3hls/5/1:C/1:A