3hls/6/1:F/1:E

Sequences
>3hls-a6-m1-cF (length=60) [Search sequence]
ATRDLVLLGEQFREEYKLTQELELTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRH
>3hls-a6-m1-cE (length=62) [Search sequence]
GSHATRDLVLLGEQFREEYKLTQELELTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANE
LR
Structure information
PDB ID 3hls (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the signaling helix coiled-coil doimain of the BETA-1 subunit of the soluble guanylyl cyclase
Assembly ID 6
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 68
Sequence identity between the two chains 0.983
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession P20595 P20595
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3hls-a6-m1-cF_3hls-a6-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3hls-assembly6.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3hls/1/1:B/1:A 3hls/2/1:C/1:D 3hls/3/1:F/1:E 3hls/4/1:G/1:H 3hls/5/1:B/1:A 3hls/5/1:C/1:D 3hls/6/1:G/1:H
Other dimers with similar sequences but different poses
  • 3hls/6/1:G/1:E 3hls/5/1:C/1:A
  • 3hls/5/1:B/1:C 3hls/5/1:D/1:A 3hls/6/1:F/1:G 3hls/6/1:H/1:E
  • [Back to Home]