3hq0/1/1:B/1:D

Sequences

>3hq0-a1-m1-cB (length=288) [Search sequence]

AMTGVLRPGHAQVRVLNLEEGIHFYRNVLGLVETGRDDQGRVYFKCWDERDHSCYIIREA
DTAGIDFFGFKVLDKATLEKLDADLQAYGLTTTRIPAGEMLETGERVRFELPSGHLIELY
AEKTCVGNGISEVNPAPWNAQREHGIAPIQLDHCLLYGPNIAEVQKIFTEVLGFYLVERV
LSPDGDSDMGIWLSCSHKVHDIAFVEYPEKGKLHHCSFLLESWEQVLRAGDIMSMNEVNV
DIGPTRHGVTRGCTIYAWDPSGNRFETFMGGYHPYPDYEPLSWTYDNF

>3hq0-a1-m1-cD (length=288) [Search sequence]

Structure information

PDB ID	3hq0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure Analysis of the 2,3-dioxygenase LapB from Pseudomonas in complex with a product
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0
PubMed citation	19828456

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q7WYF5	Q7WYF5
Species	237609 (Pseudomonas alkylphenolica)	237609 (Pseudomonas alkylphenolica)
Function annotation	BioLiP:3hq0B	BioLiP:3hq0D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3hq0-a1-m1-cB_3hq0-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3hq0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3hpv/1/1:B/1:D 3hpv/1/1:C/1:A 3hpy/1/1:A/1:C 3hpy/1/1:B/1:D 3hq0/1/1:C/1:A
Other dimers with similar sequences but different poses	3hpy/1/1:A/1:B 3hpv/1/1:B/1:A 3hpv/1/1:C/1:D 3hpy/1/1:C/1:D 3hq0/1/1:B/1:A 3hq0/1/1:D/1:C 3hpv/1/1:B/1:C 3hpv/1/1:D/1:A 3hpy/1/1:A/1:D 3hpy/1/1:B/1:C 3hq0/1/1:B/1:C 3hq0/1/1:D/1:A