3hro/1/2:A/3:A

Sequences
>3hro-a1-m2-cA (length=37) [Search sequence]
VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIM
>3hro-a1-m3-cA (length=37) [Search sequence]
VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIM
Structure information
PDB ID 3hro (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a C-terminal coiled coil domain of Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2, polycystic kidney disease 2)
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q13563 Q13563
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3hro-a1-m2-cA_3hro-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3hro-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3hrn/1/1:A/2:A 3hrn/1/1:A/3:A 3hrn/1/2:A/3:A 3hro/1/1:A/2:A 3hro/1/1:A/3:A

[Back to Home]