3hs2/2/1:B/1:C

Sequences

>3hs2-a2-m1-cB (length=56) [Search sequence]

MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEF

>3hs2-a2-m1-cC (length=58) [Search sequence]

MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFAS

Structure information

PDB ID	3hs2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of PHD truncated to residue 57 in an orthorhombic space group
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q06253	Q06253
Species	10678 (Punavirus P1)	10678 (Punavirus P1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3hs2-a2-m1-cB_3hs2-a2-m1-cC.pdb.gz

Full biological assembly Download: 3hs2-assembly2.cif.gz