3htr/1/1:B/1:A

Sequences
>3htr-a1-m1-cB (length=88) [Search sequence]
PETNETLKLIGSDKVQGTAVYGPDGEKIGSIERVIEKVSGRVSYAVLSFGGFLGIGDDHY
PLPWPALKYNVELGGYQVVTVDQLERAP
>3htr-a1-m1-cA (length=96) [Search sequence]
PETNETLKLIGSDKVQGTAVYGPDGEKIGSIERVIEKVSGRVSYAVLSFGGFLGIGDDHY
PLPWPALKYNVELGGYQVVTVDQLERAPKYGPGSEW
Structure information
PDB ID 3htr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of PRC-barrel Domain Protein from Rhodopseudomonas palustris
Assembly ID 1
Resolution 2.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 76
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q6N0K4 Q6N0K4
Species 1076 (Rhodopseudomonas palustris) 1076 (Rhodopseudomonas palustris)
Function annotation BioLiP:3htrB BioLiP:3htrA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3htr-a1-m1-cB_3htr-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3htr-assembly1.cif.gz

[Back to Home]