3hug/6/1:T/1:R

Sequences

>3hug-a6-m1-cT (length=62) [Search sequence]

DHHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAIS ES

>3hug-a6-m1-cR (length=63) [Search sequence]

DHHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAIS ESA

Structure information

PDB ID	3hug (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Mycobacterium tuberculosis anti-sigma factor RslA in complex with -35 promoter binding domain of sigL
Assembly ID	6
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	49
Sequence identity between the two chains	1.0
PubMed citation	20184899

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	T	R
UniProt accession	P9WJ67	P9WJ67
Species	83332 (Mycobacterium tuberculosis H37Rv)	83332 (Mycobacterium tuberculosis H37Rv)
Function annotation	BioLiP:3hugT	BioLiP:3hugR

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3hug-a6-m1-cT_3hug-a6-m1-cR.pdb.gz

Full biological assembly Download: 3hug-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3hug/1/1:B/1:D 3hug/2/1:F/1:H 3hug/3/1:L/1:J 3hug/4/1:P/1:N 3hug/5/1:T/1:R 3hug/6/1:B/1:D 3hug/6/1:F/1:H 3hug/6/1:L/1:J 3hug/6/1:P/1:N