3hwp/1/1:A/1:B

Sequences

>3hwp-a1-m1-cA (length=276) [Search sequence]

RNTPFTYFSLPQKLFLRNQAAVRNKPYAKYFRSERVPLSAVRKIQQGPALEDTLTPSIED
INRLLEPDFVSEESGYALLPGPAYVQSRKFFPGCTAQFKWWFIWHPAESERYTLWFPYAH
VSNPCVHHQRLRDESLSFEERLYGNTFCASEYVGDRLHLHIDFQQPASLGLNTDLYREAK
IDGSVSALSLADHPEVPVSLVHLFKEVPDGYLTSRYWVGAHPSARFPGAEKAASLLKENG
FGEAELETLAYEFAVHDCEFNHLASFLPDLYREFGT

>3hwp-a1-m1-cB (length=276) [Search sequence]

Structure information

PDB ID	3hwp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure and computational analyses provide insights into the catalytic mechanism of 2, 4-diacetylphloroglucinol hydrolase PhlG from Pseudomonas fluorescens
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	66
Sequence identity between the two chains	1.0
PubMed citation	20018877

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q4K423	Q4K423
Species	220664 (Pseudomonas protegens Pf-5)	220664 (Pseudomonas protegens Pf-5)
Function annotation	BioLiP:3hwpA	BioLiP:3hwpB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3hwp-a1-m1-cA_3hwp-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3hwp-assembly1.cif.gz