3hyk/1/1:B/1:C

Sequences

>3hyk-a1-m1-cB (length=112) [Search sequence]

AIVGIGIDIIELNRIEKLDKFERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVG TGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVAQVVLESS

>3hyk-a1-m1-cC (length=113) [Search sequence]

AIVGIGIDIIELNRIEKLDKFERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVG TGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVAQVVLESSS

Structure information

PDB ID	3hyk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	2.31 Angstrom resolution crystal structure of a holo-(acyl-carrier-protein) synthase from Bacillus anthracis str. Ames in complex with CoA (3',5'-ADP)
Assembly ID	1
Resolution	2.31Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	1.0
PubMed citation	22993090

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q81JG3	Q81JG3
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)
Function annotation	BioLiP:3hykB	BioLiP:3hykC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3hyk-a1-m1-cB_3hyk-a1-m1-cC.pdb.gz

Full biological assembly Download: 3hyk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3hyk/1/1:B/1:A 3hyk/1/1:C/1:A