3i38/7/1:F/1:B

Sequences
>3i38-a7-m1-cF (length=99) [Search sequence]
HPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKESILLTVPPGSQAGQRLRIKGKGLVH
TGDLFAVIKIVPTKPDEKARELWQQLAAAEASFDPRKTW
>3i38-a7-m1-cB (length=100) [Search sequence]
HPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKESILLTVPPGSQAGQRLRIKGKGLVS
HTGDLFAVIKIVPTKPDEKARELWQQLAAAEASFDPRKTW
Structure information
PDB ID 3i38 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a putative chaperone protein dnaj from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Assembly ID 7
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F B
UniProt accession A6TH30 A6TH30
Species 272620 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578) 272620 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3i38-a7-m1-cF_3i38-a7-m1-cB.pdb.gz
Full biological assembly
Download: 3i38-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3i38/7/1:E/1:H 3i38/7/1:I/1:C 3i38/7/1:L/1:G
Other dimers with similar sequences but different poses
  • 3i38/7/1:I/1:J 3i38/1/1:B/1:A 3i38/2/1:C/1:D 3i38/3/1:E/1:F 3i38/4/1:H/1:G 3i38/5/1:I/1:J 3i38/6/1:L/1:K 3i38/7/1:B/1:A 3i38/7/1:C/1:D 3i38/7/1:E/1:F 3i38/7/1:H/1:G 3i38/7/1:L/1:K 3lz8/1/1:A/1:B
  • [Back to Home]