3i71/4/1:B/2:B

Sequences
>3i71-a4-m1-cB (length=58) [Search sequence]
AESADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYRLKP
>3i71-a4-m2-cB (length=58) [Search sequence]
AESADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYRLKP
Structure information
PDB ID 3i71 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ethanolamine Utilization Microcompartment Shell Subunit, EutK C-terminal domain
Assembly ID 4
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P76540 P76540
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3i71-a4-m1-cB_3i71-a4-m2-cB.pdb.gz
Full biological assembly
Download: 3i71-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3i71/2/1:A/1:B 3i71/1/1:A/1:B 3i71/1/2:A/2:B
    		•

    [Back to Home]