3i7t/1/2:A/3:A

Sequences
>3i7t-a1-m2-cA (length=118) [Search sequence]
SRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGAT
LADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYV
>3i7t-a1-m3-cA (length=118) [Search sequence]
SRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGAT
LADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYV
Structure information
PDB ID 3i7t (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Rv2704, a member of highly conserved YjgF/YER057c/UK114 family, from Mycobacterium tuberculosis
Assembly ID 1
Resolution 1.93Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession O07205 O07205
Species 83332 (Mycobacterium tuberculosis H37Rv) 83332 (Mycobacterium tuberculosis H37Rv)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3i7t-a1-m2-cA_3i7t-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3i7t-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3i7t/1/1:A/2:A 3i7t/1/1:A/3:A

[Back to Home]