3i84/2/2:A/2:B

Sequences
>3i84-a2-m2-cA (length=79) [Search sequence]
GTVFTTVEDLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE
YSCVFLPEPMGTANIQLHG
>3i84-a2-m2-cB (length=85) [Search sequence]
LLGTHGGTVFTTVEDLGSKILLTCSLDDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVD
SDDQWGEYSCVFLPEPMGTANIQLH
Structure information
PDB ID 3i84 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Crystal Structure of Human EMMPRIN N-terminal Domain 1 in P6(1)22 space group
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 119
Sequence identity between the two chains 0.987
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P35613 P35613
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3i84-a2-m2-cA_3i84-a2-m2-cB.pdb.gz
Full biological assembly
Download: 3i84-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3i84/1/1:A/1:B 3i84/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 3i84/2/1:B/2:B 3i84/2/1:A/2:A
  • 3i84/2/1:A/2:B 3i84/2/2:A/1:B
  • [Back to Home]