3i9z/1/2:A/3:A

Sequences
>3i9z-a1-m2-cA (length=69) [Search sequence]
MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAI
EDQGYDVAK
>3i9z-a1-m3-cA (length=69) [Search sequence]
MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAI
EDQGYDVAK
Structure information
PDB ID 3i9z (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a metallochaperone with a trinuclear Cu(I) cluster
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
PubMed citation 19751213
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession O32221 O32221
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
Function annotation BioLiP:3i9zA BioLiP:3i9zA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3i9z-a1-m2-cA_3i9z-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3i9z-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3i9z/1/1:A/2:A 3i9z/1/1:A/3:A

[Back to Home]