3ia0/8/1:u/1:v

Sequences
>3ia0-a8-m1-cu (length=111) [Search sequence]
KERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAVAIGIMTLTPGETAMIAGDLALKA
ADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKSLE
>3ia0-a8-m1-cv (length=111) [Search sequence]
KERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAVAIGIMTLTPGETAMIAGDLALKA
ADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKSLE
Structure information
PDB ID 3ia0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ethanolamine Utilization Microcompartment Shell Subunit, EutS-G39V mutant
Assembly ID 8
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 92
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID u v
UniProt accession P63746 P63746
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ia0-a8-m1-cu_3ia0-a8-m1-cv.pdb.gz
Full biological assembly
Download: 3ia0-assembly8.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3i96/1/1:A/1:C 3i96/1/2:A/2:C 3i96/2/1:A/1:C 3ia0/1/1:A/1:B 3ia0/1/1:A/1:F 3ia0/1/1:B/1:C 3ia0/1/1:C/1:D 3ia0/1/1:D/1:E 3ia0/1/1:E/1:F 3ia0/2/1:G/1:H 3ia0/2/1:G/1:L 3ia0/2/1:H/1:I 3ia0/2/1:I/1:J 3ia0/2/1:J/1:K 3ia0/2/1:K/1:L 3ia0/3/1:M/1:N 3ia0/3/1:M/1:R 3ia0/3/1:N/1:O 3ia0/3/1:O/1:P 3ia0/3/1:P/1:Q 3ia0/3/1:Q/1:R 3ia0/4/1:S/1:T 3ia0/4/1:S/1:X 3ia0/4/1:T/1:U 3ia0/4/1:U/1:V 3ia0/4/1:V/1:W 3ia0/4/1:W/1:X 3ia0/5/1:a/1:b 3ia0/5/1:b/1:c 3ia0/5/1:c/1:d 3ia0/5/1:Y/1:d 3ia0/5/1:Y/1:Z 3ia0/5/1:Z/1:a 3ia0/6/1:e/1:f 3ia0/6/1:e/1:j 3ia0/6/1:f/1:g 3ia0/6/1:g/1:h 3ia0/6/1:h/1:i 3ia0/6/1:i/1:j 3ia0/7/1:k/1:l 3ia0/7/1:k/1:p 3ia0/7/1:l/1:m 3ia0/7/1:m/1:n 3ia0/7/1:n/1:o 3ia0/7/1:o/1:p 3ia0/8/1:q/1:r 3ia0/8/1:q/1:v 3ia0/8/1:r/1:s 3ia0/8/1:s/1:t 3ia0/8/1:t/1:u
Other dimers with similar sequences but different poses
  • 3i96/1/2:C/1:B 3i96/1/1:C/2:B
    		•

    [Back to Home]