3iab/2/1:B/2:B

Sequences
>3iab-a2-m1-cB (length=106) [Search sequence]
RVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGGKAVEK
TLALGCHFQDQKNKKIEVYTKTIEVLDEVIQLKKRAVSGVELRIYV
>3iab-a2-m2-cB (length=106) [Search sequence]
RVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGGKAVEK
TLALGCHFQDQKNKKIEVYTKTIEVLDEVIQLKKRAVSGVELRIYV
Structure information
PDB ID 3iab (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of RNase P /RNase MRP proteins Pop6, Pop7 in a complex with the P3 domain of RNase MRP RNA
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 20075859
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P38291 P38291
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:3iabB BioLiP:3iabB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3iab-a2-m1-cB_3iab-a2-m2-cB.pdb.gz
Full biological assembly
Download: 3iab-assembly2.cif.gz

[Back to Home]