3ic3/3/1:D/1:B

Sequences

>3ic3-a3-m1-cD (length=81) [Search sequence]

TGPKQQPLPPDVEGREDAIEVLRAFVLDGGLSIAFRAFDPEWGLLLVDIARHAARSYARE SEYTEDEALERIVEFEAELSR

>3ic3-a3-m1-cB (length=92) [Search sequence]

ATGPKQQPLPPDVEGREDAIEVLRAFVLDGGLSIAFRAFEDPEWGLLLVDIARHAARSYA RESEYTEDEALERIVEFEAELSRPTATTERTQ

Structure information

PDB ID	3ic3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a putative pyruvate dehydrogenase from the photosynthetic bacterium Rhodopseudomonas palustrus CGA009
Assembly ID	3
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	Q6N5V5	Q6N5V5
Species	1076 (Rhodopseudomonas palustris)	1076 (Rhodopseudomonas palustris)
Function annotation	BioLiP:3ic3D	BioLiP:3ic3B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3ic3-a3-m1-cD_3ic3-a3-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3ic3-assembly3.cif.gz