3ic8/2/1:B/1:A

Sequences

>3ic8-a2-m1-cB (length=268) [Search sequence]

SELILHHYPTSLFAEKARLLGFKGVNWRSVTIPSIPKPDLTALTGGYRKTPVLQIGADIY
CDTALARRLEQEKASPAFYPQGQEFAVAGLAAWADSVLFLHAVSLVFQPESPVEQVKHQW
PTFSRLESQLSHGGDFLFGAPSIADFSVAHTLWFLKQTPVTAPFVDDYPSVSVWLDRVLG
FGHGSLSDLSSAAAIEIASNATPAPLPDETFIDPNGFKAGDKVAIAAVEAVEGELFTGRE
ELILRREDNRAGVVHVHFPRLGFRVEKR

>3ic8-a2-m1-cA (length=272) [Search sequence]

Structure information

PDB ID	3ic8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Crystal Structure of a GST-like protein from Pseudomonas syringae to 2.4A
Assembly ID	2
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	66
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q887M8	Q887M8
Species	323 (Pseudomonas syringae pv. tomato)	323 (Pseudomonas syringae pv. tomato)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3ic8-a2-m1-cB_3ic8-a2-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3ic8-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3ic8/3/1:C/1:D 3ic8/1/1:C/1:D