3ie9/2/3:A/6:A

Sequences
>3ie9-a2-m3-cA (length=105) [Search sequence]
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAG
VLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
>3ie9-a2-m6-cA (length=105) [Search sequence]
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAG
VLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Structure information
PDB ID 3ie9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of oxidized M98L mutant of amicyanin
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
PubMed citation 19715303
Chain information
Chain 1 Chain 2
Model ID 3 6
Chain ID A A
UniProt accession P22364 P22364
Species 266 (Paracoccus denitrificans) 266 (Paracoccus denitrificans)
Function annotation BioLiP:3ie9A BioLiP:3ie9A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ie9-a2-m3-cA_3ie9-a2-m6-cA.pdb.gz
Full biological assembly
Download: 3ie9-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ie9/2/1:A/5:A 3ie9/2/2:A/4:A 3iea/2/1:A/5:A 3iea/2/2:A/4:A 3iea/2/3:A/6:A
Other dimers with similar sequences but different poses
  • 3ie9/3/2:A/3:A 3ie9/2/1:A/2:A 3ie9/2/1:A/3:A 3ie9/2/2:A/3:A 3ie9/2/4:A/5:A 3ie9/2/4:A/6:A 3ie9/2/5:A/6:A 3ie9/3/1:A/2:A 3ie9/3/1:A/3:A 3iea/2/1:A/2:A 3iea/2/1:A/3:A 3iea/2/2:A/3:A 3iea/2/4:A/5:A 3iea/2/4:A/6:A 3iea/2/5:A/6:A
  • [Back to Home]