3igm/1/1:A/1:B

Sequences
>3igm-a1-m1-cA (length=56) [Search sequence]
MSSGYPGVSWNKRMCAWLAFFYDGASRRSRTFHPKHFNMDKEKARLAAVEFMKTVE
>3igm-a1-m1-cB (length=62) [Search sequence]
MSSGYPGVSWNKRMCAWLAFFYDGASRRSRTFHPKHFNMDKEKARLAAVEFMKTVENNGR
KK
Structure information
PDB ID 3igm (database links: RCSB PDB PDBe PDBj PDBsum)
Title A 2.2A crystal structure of the AP2 domain of PF14_0633 from P. falciparum, bound as a domain-swapped dimer to its cognate DNA
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 1.0
PubMed citation 19913037
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8IKH2 Q8IKH2
Species 36329 (Plasmodium falciparum 3D7) 36329 (Plasmodium falciparum 3D7)
Function annotation BioLiP:3igmA BioLiP:3igmB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3igm-a1-m1-cA_3igm-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3igm-assembly1.cif.gz

[Back to Home]