3im4/1/1:B/1:A

Sequences
>3im4-a1-m1-cB (length=49) [Search sequence]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEA
>3im4-a1-m1-cA (length=50) [Search sequence]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK
Structure information
PDB ID 3im4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in complex with dual-specific A-Kinase Anchoring Protein 2
Assembly ID 1
Resolution 2.285Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
PubMed citation 20159461
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P00514 P00514
Species 9913 (Bos taurus) 9913 (Bos taurus)
Function annotation BioLiP:3im4B BioLiP:3im4A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3im4-a1-m1-cB_3im4-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3im4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3im3/1/1:A/2:A 5hvz/1/1:B/1:A

[Back to Home]