3iwd/1/1:B/1:D

Sequences

>3iwd-a1-m1-cB (length=61) [Search sequence]

KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS E

>3iwd-a1-m1-cD (length=61) [Search sequence]

KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS E

Structure information

PDB ID	3iwd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	T. maritima AdoMetDC complex with 5'-Deoxy-5'-dimethyl thioadenosine
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0
PubMed citation	20124698

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q9WZC3	Q9WZC3
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)
Function annotation	BioLiP:3iwdB	BioLiP:3iwdD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3iwd-a1-m1-cB_3iwd-a1-m1-cD.pdb.gz

Full biological assembly Download: 3iwd-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3iwb/1/1:B/1:D 3iwc/1/1:B/1:D
Other dimers with similar sequences but different poses	1tlu/1/1:A/1:B 1tmi/1/1:A/1:B 1vr7/1/1:B/1:A 3iwb/1/1:A/1:C 3iwc/1/1:C/1:A 3iwd/1/1:A/1:C