3iwf/1/1:A/1:B

Sequences

>3iwf-a1-m1-cA (length=87) [Search sequence]

PNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNTSQEIANQLETSSTSIIRLSKKVTPG GFNELKTRLSKFLPKEVTQYNNKLHSR

>3iwf-a1-m1-cB (length=88) [Search sequence]

PNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNTSQEIANQLETSSTSIIRLSKKVTPG GFNELKTRLSKFLPKEVTQYNVNKLHSR

Structure information

PDB ID	3iwf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Crystal Structure of the N-terminal domain of a RpiR Transcriptional Regulator from Staphylococcus epidermidis to 1.4A
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	30
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A0A0H2VHQ2	A0A0H2VHQ2
Species	176280 (Staphylococcus epidermidis ATCC 12228)	176280 (Staphylococcus epidermidis ATCC 12228)
Function annotation	BioLiP:3iwfA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3iwf-a1-m1-cA_3iwf-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3iwf-assembly1.cif.gz