3j1w/1/1:W/1:X

Sequences

>3j1w-a1-m1-cW (length=106) [Search sequence]

PYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEI QVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPW

>3j1w-a1-m1-cX (length=106) [Search sequence]

PYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEI QVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPW

Structure information

PDB ID	3j1w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A refined model of the prototypical Salmonella typhimurium T3SS basal body reveals the molecular basis for its assembly
Assembly ID	1
Resolution	11.7Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	W	X
UniProt accession	P41783	P41783
Species	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3j1w-a1-m1-cW_3j1w-a1-m1-cX.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3j1w-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3j1w/1/1:A/1:B 3j1w/1/1:A/1:X 3j1w/1/1:B/1:C 3j1w/1/1:C/1:D 3j1w/1/1:D/1:E 3j1w/1/1:E/1:F 3j1w/1/1:F/1:G 3j1w/1/1:G/1:H 3j1w/1/1:H/1:I 3j1w/1/1:I/1:J 3j1w/1/1:J/1:K 3j1w/1/1:K/1:L 3j1w/1/1:L/1:M 3j1w/1/1:M/1:N 3j1w/1/1:N/1:O 3j1w/1/1:O/1:P 3j1w/1/1:P/1:Q 3j1w/1/1:Q/1:R 3j1w/1/1:R/1:S 3j1w/1/1:S/1:T 3j1w/1/1:T/1:U 3j1w/1/1:U/1:V 3j1w/1/1:V/1:W
Other dimers with similar sequences but different poses	4g2s/1/1:D/1:E 4g2s/1/1:A/1:B 4g2s/1/1:A/1:F 4g2s/1/1:B/1:C 4g2s/1/1:C/1:D 4g2s/1/1:E/1:F