3jq7/1/1:A/1:D

Sequences

>3jq7-a1-m1-cA (length=247) [Search sequence]

EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQAD
LTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAP
FLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNG
VAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDG
GLSLVHA

>3jq7-a1-m1-cD (length=247) [Search sequence]

Structure information

PDB ID	3jq7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of pteridine reductase 1 (PTR1) from Trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6-phenylpteridine-2,4,7-triamine (DX2)
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	37
Sequence identity between the two chains	1.0
PubMed citation	19916554

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q581W1	Q581W1
Species	5691 (Trypanosoma brucei)	5691 (Trypanosoma brucei)
Function annotation	BioLiP:3jq7A	BioLiP:3jq7D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3jq7-a1-m1-cA_3jq7-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3jq7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2wd7/1/1:B/1:C 3jqa/1/1:B/1:C 4wcf/1/1:A/1:D 4wcf/1/1:B/1:C
Other dimers with similar sequences but different poses	3jq7/1/1:C/1:A 2wd7/1/1:B/1:D 3jqa/1/1:B/1:D 4wcf/1/1:B/1:D 4wcf/1/1:C/1:A 3jqf/1/1:C/1:D 3jq7/1/1:B/1:A 3jq7/1/1:C/1:D 3jqg/1/1:C/1:D 4wcf/1/1:B/1:A