3juz/1/1:A/2:A

Sequences
>3juz-a1-m1-cA (length=101) [Search sequence]
TSELRICRIDKESGPCTGGEELYLLCDKVQKEDISVRFSTASWEGRGDFSQADVHRQIAI
VFKTPPYEDLEISEPVTVNVQLQRLTDGECSEPLPFTYLPR
>3juz-a1-m2-cA (length=101) [Search sequence]
TSELRICRIDKESGPCTGGEELYLLCDKVQKEDISVRFSTASWEGRGDFSQADVHRQIAI
VFKTPPYEDLEISEPVTVNVQLQRLTDGECSEPLPFTYLPR
Structure information
PDB ID 3juz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a mutant of RelB dimerization domain(M5)
Assembly ID 1
Resolution 2.51Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 343
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q04863 Q04863
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3juz-a1-m1-cA_3juz-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3juz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zk9/1/1:A/2:A 1zka/1/1:A/2:A 3jss/1/1:A/2:A 3jv0/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 4jhb/1/1:A/2:A 4jgm/1/1:A/2:A
    		•

    [Back to Home]