3k0t/1/1:A/1:B

Sequences
>3k0t-a1-m1-cA (length=119) [Search sequence]
KTVITSDKAPAAIGPYSQAIKAGNTVYSGQIPLDPSTELVEGIEAQITQVFENLKSVAQA
AGGSFKDIVKLNIFLTDLGHFAKVNEIGSYFSQPYPARAAIGVAALPRGAQVEDAILVI
>3k0t-a1-m1-cB (length=119) [Search sequence]
KTVITSDKAPAAIGPYSQAIKAGNTVYSGQIPLDPSTELVEGIEAQITQVFENLKSVAQA
AGGSFKDIVKLNIFLTDLGHFAKVNEIGSYFSQPYPARAAIGVAALPRGAQVEDAILVI
Structure information
PDB ID 3k0t (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of PSPTO -PSP protein in complex with D-beta-Glucose from Pseudomonas syringae pv. tomato str. DC3000
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 68
Sequence identity between the two chains 1.0
PubMed citation 20478270
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q88BE5 Q88BE5
Species 323 (Pseudomonas syringae pv. tomato) 323 (Pseudomonas syringae pv. tomato)
Function annotation BioLiP:3k0tA BioLiP:3k0tB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3k0t-a1-m1-cA_3k0t-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3k0t-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3k0t/1/1:A/1:C 3k0t/1/1:B/1:C

[Back to Home]