3k1s/4/2:B/2:C

Sequences
>3k1s-a4-m2-cB (length=100) [Search sequence]
TTAEQIPFQLILNSGNARSFAEALQFAKQGKAEADEAVKAKEAINEAHHFQTELIQSEAR
GEKTEISVLLIHAQDHLNAITVKELAAEFIDLYKKLEAKG
>3k1s-a4-m2-cC (length=100) [Search sequence]
TTAEQIPFQLILNSGNARSFAEALQFAKQGKAEADEAVKAKEAINEAHHFQTELIQSEAR
GEKTEISVLLIHAQDHLNAITVKELAAEFIDLYKKLEAKG
Structure information
PDB ID 3k1s (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the PTS Cellobiose Specific Enzyme IIA from Bacillus anthracis
Assembly ID 4
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B C
UniProt accession A0A6H3A5D1 A0A6H3A5D1
Species 1392 (Bacillus anthracis) 1392 (Bacillus anthracis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3k1s-a4-m2-cB_3k1s-a4-m2-cC.pdb.gz
Full biological assembly
Download: 3k1s-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3k1s/1/1:B/1:A 3k1s/1/1:B/1:C 3k1s/1/1:C/1:A 3k1s/2/1:E/1:D 3k1s/2/1:E/1:F 3k1s/2/1:F/1:D 3k1s/3/1:G/1:H 3k1s/3/1:G/1:I 3k1s/3/1:H/1:I 3k1s/4/1:B/1:A 3k1s/4/1:B/1:C 3k1s/4/1:C/1:A 3k1s/4/2:B/2:A 3k1s/4/2:C/2:A 3k1s/5/1:E/1:D 3k1s/5/1:E/1:F 3k1s/5/1:F/1:D 3k1s/5/3:G/3:H 3k1s/5/3:G/3:I 3k1s/5/3:H/3:I
Other dimers with similar sequences but different poses
  • 3k1s/5/3:H/1:D 3k1s/4/1:A/2:A
  • 3k1s/4/2:C/1:A 3k1s/4/1:C/2:A 3k1s/5/1:F/3:H 3k1s/5/3:I/1:D
    		•

    [Back to Home]