3k1s/5/3:H/1:D

Sequences

>3k1s-a5-m3-cH (length=100) [Search sequence]

TTAEQIPFQLILNSGNARSFAEALQFAKQGKAEADEAVKAKEAINEAHHFQTELIQSEAR GEKTEISVLLIHAQDHLNAITVKELAAEFIDLYKKLEAKG

>3k1s-a5-m1-cD (length=103) [Search sequence]

SNATTAEQIPFQLILNSGNARSFAEALQFAKQGKAEADEAVKAKEAINEAHHFQTELIQS EARGEKTEISVLLIHAQDHLNAITVKELAAEFIDLYKKLEAKG

Structure information

PDB ID	3k1s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the PTS Cellobiose Specific Enzyme IIA from Bacillus anthracis
Assembly ID	5
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	1
Chain ID	H	D
UniProt accession	A0A6H3A5D1	A0A6H3A5D1
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3k1s-a5-m3-cH_3k1s-a5-m1-cD.pdb.gz

Full biological assembly Download: 3k1s-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3k1s/4/2:B/2:C 3k1s/1/1:B/1:A 3k1s/1/1:B/1:C 3k1s/1/1:C/1:A 3k1s/2/1:E/1:D 3k1s/2/1:E/1:F 3k1s/2/1:F/1:D 3k1s/3/1:G/1:H 3k1s/3/1:G/1:I 3k1s/3/1:H/1:I 3k1s/4/1:B/1:A 3k1s/4/1:B/1:C 3k1s/4/1:C/1:A 3k1s/4/2:B/2:A 3k1s/4/2:C/2:A 3k1s/5/1:E/1:D 3k1s/5/1:E/1:F 3k1s/5/1:F/1:D 3k1s/5/3:G/3:H 3k1s/5/3:G/3:I 3k1s/5/3:H/3:I 3k1s/4/2:C/1:A 3k1s/4/1:C/2:A 3k1s/5/1:F/3:H 3k1s/5/3:I/1:D