3k2a/3/4:B/8:B

Sequences
>3k2a-a3-m4-cB (length=54) [Search sequence]
FPKVATNIRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQP
>3k2a-a3-m8-cB (length=54) [Search sequence]
FPKVATNIRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQP
Structure information
PDB ID 3k2a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the homeobox domain of human homeobox protein Meis2
Assembly ID 3
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 8
Chain ID B B
UniProt accession O14770 O14770
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3k2a-a3-m4-cB_3k2a-a3-m8-cB.pdb.gz
Full biological assembly
Download: 3k2a-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3k2a/3/1:A/7:A 3k2a/3/1:B/6:B 3k2a/3/2:A/8:A 3k2a/3/2:B/5:B 3k2a/3/3:A/5:A 3k2a/3/3:B/7:B 3k2a/3/4:A/6:A
Other dimers with similar sequences but different poses
  • 3k2a/3/4:A/8:B 3k2a/3/1:A/6:B 3k2a/3/1:A/7:B 3k2a/3/2:A/5:B 3k2a/3/2:A/8:B 3k2a/3/3:A/5:B 3k2a/3/3:A/7:B 3k2a/3/4:A/6:B 3k2a/3/5:A/2:B 3k2a/3/5:A/3:B 3k2a/3/6:A/1:B 3k2a/3/6:A/4:B 3k2a/3/7:A/1:B 3k2a/3/7:A/3:B 3k2a/3/8:A/2:B 3k2a/3/8:A/4:B
  • [Back to Home]