3k33/1/2:D/2:C

Sequences

>3k33-a1-m2-cD (length=71) [Search sequence]

QSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFD TLDSTNKELVN

>3k33-a1-m2-cC (length=73) [Search sequence]

MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLF DTLDSTNKELVNR

Structure information

PDB ID	3k33 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Phd-Doc complex
Assembly ID	1
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	96
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	D	C
UniProt accession	Q06253	Q06253
Species	10678 (Punavirus P1)	10678 (Punavirus P1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3k33-a1-m2-cD_3k33-a1-m2-cC.pdb.gz

Full biological assembly Download: 3k33-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3hry/1/1:B/1:A 3hs2/1/1:A/1:B 3hs2/2/1:D/1:C 3hs2/3/1:E/1:F 3hs2/4/1:G/1:H 3k33/1/1:B/2:B 3k33/1/1:D/1:C 3kh2/1/1:E/1:F 4zlx/1/1:A/1:B 4zm0/1/1:A/1:B 4zm0/2/1:D/1:C 4zm2/1/1:A/1:B 4zm2/2/1:D/1:C