3k6c/1/1:E/1:F

Sequences

>3k6c-a1-m1-cE (length=89) [Search sequence]

DGYFEPTQELSDETRDHRAIISLREELEAVDLYNQRVNACKDKELKAILAHNRDEEKEHA ALLEWIRRCDPAFDKELKDYLFTNKPIAH

>3k6c-a1-m1-cF (length=89) [Search sequence]

DGYFEPTQELSDETRDHRAIISLREELEAVDLYNQRVNACKDKELKAILAHNRDEEKEHA ALLEWIRRCDPAFDKELKDYLFTNKPIAH

Structure information

PDB ID	3k6c (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of protein ne0167 from nitrosomonas europaea
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	127
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	Q82XT5	Q82XT5
Species	915 (Nitrosomonas europaea)	915 (Nitrosomonas europaea)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3k6c-a1-m1-cE_3k6c-a1-m1-cF.pdb.gz

Full biological assembly Download: 3k6c-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3k6c/1/1:B/1:A 3k6c/1/1:C/1:D 3k6c/1/1:G/1:H 3k6c/1/1:J/1:I
Other dimers with similar sequences but different poses	3k6c/1/1:B/1:J 3k6c/1/1:A/1:C 3k6c/1/1:A/1:I 3k6c/1/1:B/1:D 3k6c/1/1:C/1:E 3k6c/1/1:E/1:H 3k6c/1/1:F/1:D 3k6c/1/1:F/1:G 3k6c/1/1:H/1:I 3k6c/1/1:J/1:G 3k6c/1/1:J/1:A 3k6c/1/1:B/1:C 3k6c/1/1:E/1:D 3k6c/1/1:F/1:H 3k6c/1/1:G/1:I