3k7z/1/1:C/1:A

Sequences
>3k7z-a1-m1-cC (length=29) [Search sequence]
KQLEDKVEELLSKAYHLENEVARLKKLVG
>3k7z-a1-m1-cA (length=31) [Search sequence]
RMKQLEDKVEELLSKAYHLENEVARLKKLVG
Structure information
PDB ID 3k7z (database links: RCSB PDB PDBe PDBj PDBsum)
Title GCN4-Leucine zipper core mutant as N16A trigonal automatic solution
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
PubMed citation 14752198
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
Function annotation BioLiP:3k7zA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3k7z-a1-m1-cC_3k7z-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3k7z-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1ce9/3/1:A/1:B 1ce9/1/1:A/1:B 1ce9/1/1:C/1:D 1ce9/2/1:C/1:D 1zik/1/1:A/1:B 1zil/1/1:A/1:B 2zta/1/1:A/1:B 4dmd/1/1:A/1:B 4hu5/1/1:B/1:A 4hu6/1/1:B/1:A 4hu6/2/1:C/1:D 4nj0/1/1:A/1:B 4nj1/1/1:A/1:B 5iir/1/1:A/1:B 5iiv/1/1:A/1:B 6o2e/1/1:A/2:A
  • 1ij2/1/1:A/1:C 1ij0/1/1:A/1:B 1ij0/1/1:A/1:C 1ij0/1/1:B/1:C 1ij1/1/1:A/1:B 1ij1/1/1:A/1:C 1ij1/1/1:B/1:C 1ij2/1/1:A/1:B 1ij2/1/1:C/1:B 1ij3/1/1:B/1:A 1ij3/1/1:B/1:C 1ij3/1/1:C/1:A 1rb4/1/1:A/1:B 1swi/1/1:B/1:A 1swi/1/1:B/1:C 1swi/1/1:C/1:A 1zim/1/1:A/1:B 1zim/1/1:A/1:C 1zim/1/1:B/1:C 3k7z/1/1:A/1:B 4dme/1/1:A/1:B 4dme/1/1:A/1:C 4dme/1/1:B/1:C 6xne/1/1:B/1:C 6xnf/1/1:B/1:C 6xnl/1/1:B/1:C 6xnm/1/1:A/1:C
  • 1rb6/1/1:C/1:B 1rb4/1/1:C/1:B 3k7z/1/1:C/1:B
  • 3m48/1/1:A/2:A 3i1g/1/1:A/2:A
  • 3i5c/1/1:A/1:B 5iew/1/1:A/1:B
  • [Back to Home]