3k8r/1/1:B/1:A

Sequences

>3k8r-a1-m1-cB (length=81) [Search sequence]

NEPRAAKARYDRSSARVIVDLENGCTFAFPPRLAQGLEGASDDQLCAVEILGQGYGLHWE TLDVDLSLPGLAGIFGTKAWA

>3k8r-a1-m1-cA (length=83) [Search sequence]

EPRAAKARYDRSSARVIVDLENGCTFAFPPRLAQGLEGASDDQLCAVEILGQGYGLHWET LDVDLSLPGLAGIFGTKAWAKRA

Structure information

PDB ID	3k8r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of protein of unknown function (YP_427503.1) from Rhodospirillum rubrum ATCC 11170 at 2.75 A resolution
Assembly ID	1
Resolution	2.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	0.988

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q2RRM9	Q2RRM9
Species	269796 (Rhodospirillum rubrum ATCC 11170)	269796 (Rhodospirillum rubrum ATCC 11170)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3k8r-a1-m1-cB_3k8r-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3k8r-assembly1.cif.gz