3k9r/4/2:D/1:B

Sequences
>3k9r-a4-m2-cD (length=95) [Search sequence]
DAHVLKSRLEPAFTILDVRDRSTYNDGHIGAAPIEDLVDRASSSLEKSRDIYVYGAGDEQ
TSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEL
>3k9r-a4-m1-cB (length=98) [Search sequence]
DAHVLKSRLEWGEPAFTILDVRDRSTYNDGHIGAAPIEDLVDRASSSLEKSRDIYVYGAG
DEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEL
Structure information
PDB ID 3k9r (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of the Rhodanese-like domain of the Alr3790 protein from Anabaena sp. Northeast Structural Genomics Consortium Target NsR437c.
Assembly ID 4
Resolution 1.96Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID D B
UniProt accession Q8YQN0 Q8YQN0
Species 103690 (Nostoc sp. PCC 7120 = FACHB-418) 103690 (Nostoc sp. PCC 7120 = FACHB-418)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3k9r-a4-m2-cD_3k9r-a4-m1-cB.pdb.gz
Full biological assembly
Download: 3k9r-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3k9r/1/1:A/2:C 3k9r/1/2:D/1:B 3k9r/3/1:A/2:C
Other dimers with similar sequences but different poses
  • 3hix/5/1:C/3:C 3hix/4/1:A/2:B
  • 3ilm/2/1:D/1:C 3ilm/1/1:A/1:B
  • 3k9r/5/1:D/1:C 3k9r/1/1:A/1:B 3k9r/1/2:D/2:C 3k9r/2/1:A/1:B
  • [Back to Home]