3kch/3/1:C/4:C

Sequences
>3kch-a3-m1-cC (length=108) [Search sequence]
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGK
LPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
>3kch-a3-m4-cC (length=108) [Search sequence]
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGK
LPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Structure information
PDB ID 3kch (database links: RCSB PDB PDBe PDBj PDBsum)
Title Baranase crosslinked by glutaraldehyde
Assembly ID 3
Resolution 1.94Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID C C
UniProt accession P00648 P00648
Species 1390 (Bacillus amyloliquefaciens) 1390 (Bacillus amyloliquefaciens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3kch-a3-m1-cC_3kch-a3-m4-cC.pdb.gz
Full biological assembly
Download: 3kch-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3kch/1/1:A/2:A 3kch/2/1:B/3:B
Other dimers with similar sequences but different poses
  • 1yvs/2/5:A/6:A 1yvs/1/1:A/2:A 1yvs/1/1:A/3:A 1yvs/1/2:A/3:A 1yvs/2/1:A/2:A 1yvs/2/1:A/3:A 1yvs/2/2:A/3:A 1yvs/2/4:A/5:A 1yvs/2/4:A/6:A
  • 1yvs/2/3:A/6:A 1yvs/2/1:A/5:A 1yvs/2/2:A/4:A
  • [Back to Home]