3kcw/1/1:A/2:A

Sequences
>3kcw-a1-m1-cA (length=110) [Search sequence]
SDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTYRVVVSGKDLGV
RPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPDTGNNFIVAQWN
>3kcw-a1-m2-cA (length=110) [Search sequence]
SDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTYRVVVSGKDLGV
RPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPDTGNNFIVAQWN
Structure information
PDB ID 3kcw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Ganoderma fungal immunomodulatory protein, GMI
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 102
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession E7FH75 E7FH75
Species 34462 (Ganoderma microsporum) 34462 (Ganoderma microsporum)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3kcw-a1-m1-cA_3kcw-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3kcw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7wdm/1/1:A/3:A 7wdm/1/2:A/4:A
Other dimers with similar sequences but different poses
  • 7wdm/1/3:A/4:A 7wdm/1/1:A/2:A
  • 7wdm/1/1:A/4:A 7wdm/1/2:A/3:A
  • [Back to Home]