3ker/1/1:B/1:C

Sequences
>3ker-a1-m1-cB (length=117) [Search sequence]
PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLL
VSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
>3ker-a1-m1-cC (length=117) [Search sequence]
PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLL
VSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
Structure information
PDB ID 3ker (database links: RCSB PDB PDBe PDBj PDBsum)
Title D-Dopachrome tautomerase (D-DT)/ macrophage migration inhibitory factor 2 (MIF2) complexed with inhibitor 4-IPP
Assembly ID 1
Resolution 2.78Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
PubMed citation 25016026
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O35215 O35215
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:3kerB BioLiP:3kerC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ker-a1-m1-cB_3ker-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ker-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ker/1/1:A/1:B 3ker/1/1:A/1:C

[Back to Home]