3ker/1/1:B/1:C

Sequences

>3ker-a1-m1-cB (length=117) [Search sequence]

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLL VSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL

>3ker-a1-m1-cC (length=117) [Search sequence]

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLL VSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL

Structure information

PDB ID	3ker (database links: RCSB PDB PDBe PDBj PDBsum)
Title	D-Dopachrome tautomerase (D-DT)/ macrophage migration inhibitory factor 2 (MIF2) complexed with inhibitor 4-IPP
Assembly ID	1
Resolution	2.78Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	90
Sequence identity between the two chains	1.0
PubMed citation	25016026

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	O35215	O35215
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:3kerB	BioLiP:3kerC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3ker-a1-m1-cB_3ker-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3ker-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ker/1/1:A/1:B 3ker/1/1:A/1:C