3kfd/3/1:C/1:D

Sequences
>3kfd-a3-m1-cC (length=112) [Search sequence]
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK
VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
>3kfd-a3-m1-cD (length=112) [Search sequence]
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK
VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Structure information
PDB ID 3kfd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
Assembly ID 3
Resolution 2.995Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 83
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P01137 P01137
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3kfd-a3-m1-cC_3kfd-a3-m1-cD.pdb.gz
Full biological assembly
Download: 3kfd-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1kla/1/1:A/1:B 1klc/1/1:A/1:B 1kld/1/1:A/1:B 3kfd/1/1:A/1:B 3kfd/2/1:C/1:D 3kfd/3/1:A/1:B 4kv5/1/1:C/1:D 4kv5/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 3rjr/2/1:D/1:C 3rjr/1/1:B/1:A 5vqf/1/1:B/1:A 5vqf/2/1:D/1:C 6gff/1/1:D/1:B 6gff/2/1:H/1:F
  • [Back to Home]