3kg0/3/1:C/2:A

Sequences
>3kg0-a3-m1-cC (length=97) [Search sequence]
DADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVNIAVWTD
HDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTL
>3kg0-a3-m2-cA (length=97) [Search sequence]
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVNIAVWTDH
DAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLP
Structure information
PDB ID 3kg0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SnoaB, a cofactor-independent oxygenase from Streptomyces nogalater, determined to 1.7 resolution
Assembly ID 3
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C A
UniProt accession O54259 O54259
Species 38314 (Streptomyces nogalater) 38314 (Streptomyces nogalater)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3kg0-a3-m1-cC_3kg0-a3-m2-cA.pdb.gz
Full biological assembly
Download: 3kg0-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3kg0/1/1:A/2:C 3kg0/2/1:B/3:B 3kg1/1/1:C/2:A 3kg1/2/1:B/3:B 3kg1/3/1:C/2:A 3kng/1/1:A/1:B

[Back to Home]