3kif/3/1:G/1:J

Sequences
>3kif-a3-m1-cG (length=88) [Search sequence]
WMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGGW
SGFKFLFFHPNGYLYAVRGQRFYKALPP
>3kif-a3-m1-cJ (length=93) [Search sequence]
NWMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGG
WSGFKFLFFHPNGYLYAVRGQRFYKALPPVSNQ
Structure information
PDB ID 3kif (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (Lib1-B7-18 and Lib2-D2-15)
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 20368465
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G J
UniProt accession Q27084 Q27084
Species 32630 (synthetic construct) 32630 (synthetic construct)
Function annotation BioLiP:3kifG BioLiP:3kifJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3kif-a3-m1-cG_3kif-a3-m1-cJ.pdb.gz
Full biological assembly
Download: 3kif-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3kif/3/1:G/1:F 3kif/1/1:B/1:A 3kif/1/1:D/1:E 3kif/1/1:G/1:F 3kif/2/1:B/1:A 3kif/2/1:D/1:E
  • 3kif/3/1:H/1:F 3kif/1/1:C/1:A 3kif/1/1:H/1:F 3kif/2/1:C/1:A
  • 3kif/3/1:H/1:I 3kif/1/1:C/1:D 3kif/1/1:H/1:I 3kif/2/1:C/1:D
  • 3kif/3/1:H/1:J 3kif/1/1:C/1:E 3kif/1/1:H/1:J 3kif/2/1:C/1:E
  • [Back to Home]