3kif/3/1:H/1:I

Sequences

>3kif-a3-m1-cH (length=85) [Search sequence]

KEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGGWSGFKF LFFHPNGYLYAVRGQRFYKALPPVS

>3kif-a3-m1-cI (length=94) [Search sequence]

DSDNWMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIG SGGWSGFKFLFFHPNGYLYAVRGQRFYKALPPVS

Structure information

PDB ID	3kif (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (Lib1-B7-18 and Lib2-D2-15)
Assembly ID	3
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	73
Sequence identity between the two chains	1.0
PubMed citation	20368465

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	I
UniProt accession	Q27084	Q27084
Species	32630 (synthetic construct)	32630 (synthetic construct)
Function annotation	BioLiP:3kifI

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3kif-a3-m1-cH_3kif-a3-m1-cI.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3kif-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3kif/1/1:C/1:D 3kif/1/1:H/1:I 3kif/2/1:C/1:D
Other dimers with similar sequences but different poses	3kif/3/1:G/1:F 3kif/1/1:B/1:A 3kif/1/1:D/1:E 3kif/1/1:G/1:F 3kif/2/1:B/1:A 3kif/2/1:D/1:E 3kif/3/1:H/1:F 3kif/1/1:C/1:A 3kif/1/1:H/1:F 3kif/2/1:C/1:A 3kif/3/1:H/1:J 3kif/1/1:C/1:E 3kif/1/1:H/1:J 3kif/2/1:C/1:E 3kif/3/1:G/1:J 3kif/1/1:G/1:J