3kih/1/1:E/1:B

Sequences
>3kih-a1-m1-cE (length=90) [Search sequence]
GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNWLGRAKKIGDGGWNQFQFLFFDPNGY
LYAVSKDKLYKAPPPQSDTDNWIARATEIG
>3kih-a1-m1-cB (length=95) [Search sequence]
GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWLGRAKKIGDGGWNQFQFLFFDPN
GYLYAVSKDKLYKAPPPQSDTDNWIARATEIGSGG
Structure information
PDB ID 3kih (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (Lib2-D2-15)
Assembly ID 1
Resolution 2.49Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 20368465
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E B
UniProt accession Q27084 Q27084
Species 32630 (synthetic construct) 32630 (synthetic construct)
Function annotation BioLiP:3kihB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3kih-a1-m1-cE_3kih-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3kih-assembly1.cif.gz

[Back to Home]