3kih/1/1:E/1:C

Sequences

>3kih-a1-m1-cE (length=90) [Search sequence]

GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNWLGRAKKIGDGGWNQFQFLFFDPNGY LYAVSKDKLYKAPPPQSDTDNWIARATEIG

>3kih-a1-m1-cC (length=91) [Search sequence]

GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNWLGRAKKIGDGGWNQFQFLFFDPNGY LYAVSKDKLYKAPPPQSDTDNWIARATEIGS

Structure information

PDB ID	3kih (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (Lib2-D2-15)
Assembly ID	1
Resolution	2.49Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	93
Sequence identity between the two chains	1.0
PubMed citation	20368465

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	C
UniProt accession	Q27084	Q27084
Species	32630 (synthetic construct)	32630 (synthetic construct)
Function annotation	BioLiP:3kihC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3kih-a1-m1-cE_3kih-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3kih-assembly1.cif.gz