3kkf/2/3:A/6:A

Sequences
>3kkf-a2-m3-cA (length=100) [Search sequence]
GAENNVRLSRIIIDPERLEEYNAYLKEEIEVSRLEPGVLVLYAVAEKERPNHVTILEIYA
DEAAYKSHIATPHFKKYKEGTLDVQLELIDATPLIPGLKK
>3kkf-a2-m6-cA (length=100) [Search sequence]
GAENNVRLSRIIIDPERLEEYNAYLKEEIEVSRLEPGVLVLYAVAEKERPNHVTILEIYA
DEAAYKSHIATPHFKKYKEGTLDVQLELIDATPLIPGLKK
Structure information
PDB ID 3kkf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Putative antibiotic biosynthesis monooxygenase (NP_810307.1) from Bacteriodes thetaiotaomicron VPI-5482 at 1.30 A resolution
Assembly ID 2
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 3 6
Chain ID A A
UniProt accession Q8A7Y0 Q8A7Y0
Species 818 (Bacteroides thetaiotaomicron) 818 (Bacteroides thetaiotaomicron)
Function annotation BioLiP:3kkfA BioLiP:3kkfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3kkf-a2-m3-cA_3kkf-a2-m6-cA.pdb.gz
Full biological assembly
Download: 3kkf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3kkf/1/1:A/2:A 3kkf/2/1:A/2:A 3kkf/2/4:A/5:A
Other dimers with similar sequences but different poses
  • 3kkf/2/1:A/6:A 3kkf/2/2:A/4:A 3kkf/2/3:A/5:A
  • [Back to Home]